Shop Our Top Picks

New ArrivalsTop Deals
Today's Moment

Shop by Category

Shop All Categories

Accessories

Baby & Kids

Clothing & Shoes

Crafts & Party Supplies

Electronics

Home Décor

Invitations & Stationery

Office & School

Sports, Toys & Games

Wall Art & Décor

Weddings

Create Your Own

Shop All Products

Officially Licensed Brands

Customizable Designs From Brands You Love

Find the Perfect Gift

More Ways to Save

Shop the Sale

Cherries Business Cards (Back)Cherries Business Cards (Standing Front)Cherries Business Cards (Front/Back)
Cherries Business Cards (Front)

Cherries Business Cards

4.8(35836)
$30.95 Comp. value
i
$26.31
per pack of 100
Save 15% with code FRESHFINDS4U
View Product Details

Other designs from this category

About Business Cards

Sold by

Size: Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust color and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection
  • Made and printed in the USA

About This Design

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Reviews

There are no reviews for this design yet. customer reviews for other designs.
Have you purchased this product?

Need Ideas & Inspiration?

Why Shop on Zazzle

Tags

Business Cards
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Created on: 3/24/2008, 5:47 PM
Rating: G